PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00003.1.g07780.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 250aa    MW: 26693.7 Da    PI: 9.299
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00003.1.g07780.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like46.86.6e-15781072655
                         G2-like  26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                     +A+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  Zjn_sc00003.1.g07780.1.sm.mkhc  78 EAVPKKILELMNVPGLTRENVASHLQKFRL 107
                                     69***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.0E-41541No hitNo description
TIGRFAMsTIGR015571.1E-1278107IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-1478112IPR009057Homeodomain-like
SuperFamilySSF466893.05E-879111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MAAAAQARGG EFPVGMKVLV VDDDPTCLLV LKKMLDECKY DGKEEAAPSP TPPHPAPRLG  60
YVASDDLFIG SSYRAVIEAV PKKILELMNV PGLTRENVAS HLQKFRLYLK RIAQHHAGIA  120
HPFAPSASSA KVAPLGGFDL QALAASGQIP QALAALQDEL LGRPTSSLPL PGRDQSSLRL  180
AAIKGNKPHG EREIAFGQPI YKCQNNAYGN ALGVSPKPQV VLKTESSDSL RHSYGYVSGS  240
AEFTTRSVMK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0601301e-130AB060130.1 Zea mays ZmRR8 mRNA for response regulator 8, complete cds.
GenBankEU9755451e-130EU975545.1 Zea mays clone 492147 two-component response regulator ARR1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001104861.11e-76response regulator 8
RefseqXP_008648025.14e-77PREDICTED: response regulator 8 isoform X1
SwissprotA2XE311e-76ORR21_ORYSI; Two-component response regulator ORR21
SwissprotQ8H7S71e-76ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLQ9AV931e-76Q9AV93_MAIZE; Response regulator 8
STRINGGRMZM2G099797_P014e-76(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57963754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-27response regulator 2